GenScript Glucagon-Like Peptide (Glp) I (7-36), Amide, Human; 0.5mg

Name: GenScript Glucagon-Like Peptide (Glp) I (7-36), Amide, Human; 0.5mg
SKU: GSCRPT-RP10773-0.5
Price: 90.00 USD

List Price $90.00 Your Price $90.00

GenScript Glucagon-Like Peptide (Glp) I (7-36), Amide, Human - GSCRPT (Additional S&H or Hazmat Fees May Apply)

NETA PART: GSCRPT-RP10773-0.5

MFG.PART: RP10773-0.5

UNSPSC: 41105322

Manufacturer: GenScript USA Inc

Description

Overview

Synonyms	GLP-1 (7-36), amide, humanGlucagon Like PeptideI; Glucagon Like Peptide 1; Glucagon Like Peptide1; GLP-I; GLPI; GLP-1; GLP1
Description	Glucagon-Like Peptide I (7-36) (GLP)-1 (7-36)-NH₂ is a peptide found in the mucosal endocrine cells of the intestine, and plasma levels of Glucagon-Like Peptide I (7-36)-NH₂ immunoreactivity show a rise after the ingestion of a fat or mixed-component meal. The effects of physiological infusion of Glucagon-Like Peptide I (7-36)-NH₂ on a submaximal gastric acid secretion in healthy volunteers at a rate known to mimic the observed postprandial rise in plasma concentrations. Some results suggest a novel role for Glucagon-Like Peptide I (7-36)-NH₂ as a physiological inhibitor of gastric acid secretion in humans.
Cas No	107444-51-9
Sequence	{HIS}{ALA}{GLU}{GLY}{THR}{PHE}{THR}{SER}{ASP}{VAL}{SER}{SER}{TYR}{LEU}{GLU}{GLY}{GLN}{ALA}{ALA}{LYS}{GLU}{PHE}{ILE}{ALA}{TRP}{LEU}{VAL}{LYS}{GLY}{ARG}-NH₂
Sequence Shortening	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH₂
Molecular Formula	C₁₄₉H₂₂₆N₄₀O₄₅
C Terminal	NH₂
Molecular Weight	3297.5

Properties

Purity	> 95%
Solubility	Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
Form	Lyophilized
Storage	Store at -20°C. Keep tightly closed. Store in a cool dry place.

Specifications